<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1118 CA2519 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA
2 NNRTI+NRTI+PI 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S   K20T, E35D, M36I, R57K, I62V, L63P, A71T, V77I, I93L  
>CA2519| codons 1-99
PQITLWQRPLVTIKIGGQLTEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGHKTIGTVLIGPTPVNIIGRSLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215Y K219KQ     K20R, E44ED, T69P, K102R, K173N, H208Y, R211K, L228LH, A272S, T286A  
>CA2520| codons 1-298
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSPRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRNQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTEVIPLTEE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001