<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LVLBV30_10 LVLBV30_10 Gabon 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I I13A, K20I, M36I, R41K, I62V, L63P, H69K, L89M  
>LVLBV30_10| codons 1-99
PQITLWQRPLITAKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K122E, D123N, I135V, S162A, K173T, Q174K, D177E, T200A, Q207E, R211K, V245Q, E248N, T286A, E291D, V292I, I293V, P294T, S322T, I326V, G335D, R356K, M357K, R358K, G359S, A371V, I375V, T377L, K390R, E396D, T403M, E432D, V435M, A437V  
>LVLBV30_10| codons 1-437
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKKSA
HTNDVKQLTEVVQKVALESIVIWGKTPKFRLPIQKDTWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIMGV

References
Author Title Citation
Vergne, L Resistance to antiretroviral treatment in Gabon: need for implementation of guidelines on antiretroviral therapy use and HIV-1 drug resistance monitoring in developing countries. JAIDS, 2002