<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LV01B LV01B Gabon 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ D4T 78

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15V, E35D, M36I, R41K, K45R, H69K, T74S, L89M  
>LV01B| codons 1-99
PQITLWQRPVVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  K70N, V75T     V35T, T39N, T69N, K122E, D123S, I135T, S162C, K173S, Q174R, D177E, T200E, Q207A, R211S, V245Q, A272P, K275R, T286A, V292I, I293V, P294T, L295M, I326V, G335D, R356K, M357K, R358K, G359S, T369A, I375V, K390R, A400T, T403M, E404D, E432D  
>LV01B| codons 1-434
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPV
FAIKKKDSNNWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRSRNPEIVI
YQYMDDLYVGSDLEIGQHREKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLLRGAKALTEIVTMTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKKSA
HTNDVKQLAEAVQKVATESIVIWGKTPKFRLPIQKETWETWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPI

References
Author Title Citation
Vergne, L Resistance to antiretroviral treatment in Gabon: need for implementation of guidelines on antiretroviral therapy use and HIV-1 drug resistance monitoring in developing countries. JAIDS, 2002