<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I T12K, I13V, L19Q, K20I, M36I, R41K, L63P, H69K, K70R, V82I, L89I  
>ZZRJ045| codons 1-99
PQITLWQRPLIKVKIGGQQIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPINIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      A98G K20R, V35T, T39N, K49R, V60I, D123E, E169D, K173R, Q174K, D177E, T200A, Q207E, R211K, F214L, V245Q, D250E, A272PS, I274IV, K275Q, K277R, Q278N, K281KR, T286A, E291D, V292I, I293V, E297A, L301M, I329V  
>ZZRJ045| codons 1-333
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICNEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRRKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYSGVQVRNLCRLLRGAKALTDIVPLTAEAE
MELAENREILKEPVHGVYYDPSKDLIAEVQKQG

References
Author Title Citation
Imade, GE Transmitted HIV drug resistance in antiretroviral-naive pregnant women in north central Nigeria. ARHR, 2013