<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT|DDI NA
3 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, L74IV, M184MIV, T215F K219Q K103N, Y181C   K43E, V60VI, K122E, D123S, I135T, S162C, K173I, Q174K, D177E, I178M, G196E, T200A, E203D, Q207A, R211S  
>PHPT004| codons 42-227
EEEGKISKIGPENPYNTPIFAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLK
KNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQ
CSMTKILEPFRIKNPEMVICQYVDDLYVGSDLEIEQHRAKIDELRAHLLSWGFFTPDQKH
QKEPPF

References
Author Title Citation
Puthanakit, T HIV-1 drug resistance mutations in children after failure of first-line nonnucleoside reverse transcriptase inhibitor-based antiretroviral therapy. HIV Med, 2010