<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C   V35T, T39Q, E42G, S68G, K122E, D123S, I135T, A158T, K166R, R172K, K173I, Q174K, D177E, I178M, V179I, G196E, T200A, E203D, Q207A, R211S, H221Y, K238R, V245E G45R
>CR1513| codons 21-255
VKQWPLTEEKIKALTEICQEMGKERKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETP
GIRYQYNVLPQGWKGSPTIFQSSMTRILEPFKIKNPEMIICQYVDDLYVGSDLEIEQHRA
KIDELRAHLLSWGFTTPDKKYQKEPPFLWMGYELHPDRWTVQPIELPEKDSWTVN

References
Author Title Citation
Puthanakit, T HIV-1 drug resistance mutations in children after failure of first-line nonnucleoside reverse transcriptase inhibitor-based antiretroviral therapy. HIV Med, 2010