Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| IL273 | IL273 | Israel | 2001 | HIV1 | C | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | NFV+ 3TC+ AZT | 17 |
| 2 | NFV+ DDI+ D4T | 94 |
| 3 | RTV+ IDV+ ABC+ 3TC+ AZT | 26 |
| 4 | None | 16 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I15V, M36I, R41K, L63T, H69K, V82I, L89M, I93L |
| >IL273| codons 4-99 TLWQRPLVTIKVGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIT IEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF |
References
| Author | Title | Citation |
| Grossman, Z | Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. | PLoS Med, 2005 |
| Non-B Workgroup | Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. | PLoS Med, 2005 |