<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL273 IL273 Israel 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ 3TC+ AZT 17
2 NFV+ DDI+ D4T 94
3 RTV+ IDV+ ABC+ 3TC+ AZT 26
4 None 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, R41K, L63T, H69K, V82I, L89M, I93L  
>IL273| codons 4-99
TLWQRPLVTIKVGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIT
IEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

References
Author Title Citation
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005