<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL263 IL263 Israel 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ AZT 75
2 NVP+ 3TC+ AZT 107
3 None 23
4 LPV+ D4T+ DDI 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46IL, V82VA L24I W6WR, L10LI, I13V, K20I, M36I, R41K, C67E, H69K, L89M R8RQ
>IL263| codons 4-99
TLRQQPIVTVKIGGQLIEALIDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYDQIL
IEIEGKKAIGTVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70KR, M184MV, T215TFIS F77FL, K219KE Y181YC V108VI T39K, E40D, V60I, K104R, V106I, K166R, K173I, Q174K, D177E, I178ILM, T200A, Q207E, R211K, F214L, L228LR, V245Q  
>IL263| codons 37-247
ICKDLEKEGKISKIGPENPYNTPIFAIKKKDSTRWRKLVDLRELNKRTQDFWEVQLGIPH
PAGLKKKRSITILDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGS
PAIFQSSMTRILEPFRIKNPEMVICQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLST
PDEKHQKEPPFRWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005