<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL290 IL290 Israel 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC+ SQV 83
2 AZT+ D4T+ IDV 95
3 D4T+ DDI+ IDV 42

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82VA, L90LM V11VI, G73GS T12TS, I15V, L19LI, K20X, M36I, R41K, K45KR, I62IV, L63X, H69K, A71AV, L89LM, I93L  
>IL290| codons 4-99
TLWQRPLISIKVGGQIXEALLDTGADDTVLEEINLPGKWKPRMIGGIGGFIKVRQYDQVX
IEICGKKVISTVLVGPTPANIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML       T39E, E44ED, S48ST, K122E, D123G, A158AS, K173A, Q174K, D177E, T200A, Q207E, R211RK, T215X, V245Q N57NK
>IL290| codons 37-247
ICEELEKDGKITKIGPENPYKTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGS
PSIFQSSMTKILEPFRAKNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFXT
PDKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005