Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| IL224 | IL224 | Israel | 2001 | HIV1 | C | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 17 |
| 2 | AZT+ DDC+ SQV | 75 |
| 3 | AZT+ 3TC+ RTV | 115 |
| 4 | DDI+ D4T | 45 |
| 5 | AZT+ 3TC+ RTV+ IDV | 49 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| K14R, E35D, M36I, N37D, R41K, H69K |
| >IL224| codons 4-88 TLWQRPLVTIRIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDQIL IEICGKKAIGTVLVGPTPVNIIGRN |
References
| Author | Title | Citation |
| Grossman, Z | Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. | PLoS Med, 2005 |
| Non-B Workgroup | Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. | PLoS Med, 2005 |