<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL208 IL208 Israel 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 9
2 None 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39E, S48T, V60VI, A98S, K122E, D123N, K173A, D177E, T200A, I202V, Q207E, V245Q  
>IL208| codons 37-247
ICEEMEKEGKITKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PSGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRAQNPEIVIYQYMDDLYVGSDLEIGQHRAKVEELREHLLRWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, E35D, M36I, R41K, K45KR, L63P, H69K, K70KR, L89LM, I93L  
>IL208| codons 4-99
TLWQRPLVSIKVGGQIREALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYDQIP
IEICGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005