<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, G16E, L19I, K20R, E35D, M36I, K43R, L63T, H69K, T74S, L89M, I93L  
>KZN08_346242| codons 1-99
PQITLWQRPLVSIKVEGQIREALLDTGADDTVLEDINLPGRWRPKMIGGIGGFIKVRQYD
QITIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35R, T39E, S48T, S68G, K122E, D123N, I135A, S162C, K173T, Q174K, T200A, Q207A, R211K, V245N, E248D, S251N, A272P W239WR
>KZN08_346242| codons 1-274
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICEEMEKEGKITKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSANNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKRT
VQPINLPDKDNWTVNDIQKLVGKLNWASQIYPGI

References
Author Title Citation
Hunt, GM Surveillance of transmitted HIV-1 drug resistance in Gauteng and KwaZulu-Natal Provinces, South Africa, 2005-2009. Clin Infect Dis, 2012