<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KZN08_346242 KZN08_346242 South Africa 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, G16E, L19I, K20R, E35D, M36I, K43R, L63T, H69K, T74S, L89M, I93L  
>KZN08_346242| codons 1-99
PQITLWQRPLVSIKVEGQIREALLDTGADDTVLEDINLPGRWRPKMIGGIGGFIKVRQYD
QITIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35R, T39E, S48T, S68G, K122E, D123N, I135A, S162C, K173T, Q174K, T200A, Q207A, R211K, V245N, E248D, S251N, A272P W239WR
>KZN08_346242| codons 1-274
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICEEMEKEGKITKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSANNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKRT
VQPINLPDKDNWTVNDIQKLVGKLNWASQIYPGI

References
Author Title Citation
Hunt, GM Surveillance of transmitted HIV-1 drug resistance in Gauteng and KwaZulu-Natal Provinces, South Africa, 2005-2009. Clin Infect Dis, 2012