<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GP08_1046 GP08_1046 South Africa 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, N37S, R41K, L63H, H69K, I72V, L89M, I93L  
>GP08_1046| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDISLPGKWKPKMIGGIGGFIKVRQYD
QIHIEICGKKAVGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39K, K43E, S48T, V60I, K122E, D123GS, S163ST, K173A, Q174K, D177E, T200E, Q207D, V245Q, A272S, K277KR  
>GP08_1046| codons 1-277
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICKEMEEEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSTMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHREKIEELRDHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVR

References
Author Title Citation
Hunt, GM Surveillance of transmitted HIV-1 drug resistance in Gauteng and KwaZulu-Natal Provinces, South Africa, 2005-2009. Clin Infect Dis, 2012