<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL201 IL201d Israel 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 30
2 IDV+ DDI+ D4T 56
3 IDV+ AZT+ 3TC+ RTV 8
4 None 7
5 RTV+ IDV 29

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12S, I15V, L19T, M36I, R41K, L63P, I64IL, H69K, I85V, L89M, I93L  
>IL201d| codons 10-99
LVSIKVGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIPLEICGK
KAIGTVLVGPTPVNIVGRNMMTQLGCTLNF

References
Author Title Citation
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005