Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| IL201 | IL201d | Israel | 2001 | HIV1 | C | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ 3TC+ IDV | 30 |
| 2 | IDV+ DDI+ D4T | 56 |
| 3 | IDV+ AZT+ 3TC+ RTV | 8 |
| 4 | None | 7 |
| 5 | RTV+ IDV | 29 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| L90M | T12S, I15V, L19T, M36I, R41K, L63P, I64IL, H69K, I85V, L89M, I93L |
| >IL201d| codons 10-99 LVSIKVGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIPLEICGK KAIGTVLVGPTPVNIVGRNMMTQLGCTLNF |
References
| Author | Title | Citation |
| Grossman, Z | Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. | PLoS Med, 2005 |
| Non-B Workgroup | Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. | PLoS Med, 2005 |