<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL128 IL128a Israel 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 165
2 DDI+ NFV+ AZT 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L23LI I13IK, M36I, R41K, H69K, L89M, I93L G40GE
>IL128a| codons 4-99
TLWQRPLVTKKIGGQLKEAILDTGADDTVLEEINLPEKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       T39E, E44AG, K122E, D123A, R125G, I135T, K173T, D177E, T200A, Q207E F124S, K126KN
>IL128a| codons 38-244
CEELEKGGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEASGNYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRTQNPEIVIYQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPI

References
Author Title Citation
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004