<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL80 IL80 Israel 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 225
2 DDI+ AZT 8
3 RTV+ DDI+ AZT 47
4 RTV+ D4T+ DDC 39
5 NFV+ D4T+ DDC 21
6 SQV+ ABC+ 3TC 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84V K43T W6WL, T12S, L19I, K20R, E21EG, M36I, R41K, L63P, H69K, A71V, T74A, I93L G40E
>IL80| codons 4-99
TLLQRPLVSIKIGGQIRGALLDTGADDTVLEEINLPEKWTPKMIGGIGGFVKVRQYDQIP
IEICGKKVIGAVLVGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y     A98G T39E, S48T, V60I, G112X, K122E, D123A, A158S, K173A, Q174K, D177E, T200A, Q207E, R211K, V245Q P119PH, F124I
>IL80| codons 37-247
ICEELEKEGKITKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PGGLKKKKSVTVLDVXDAYFSVHLDEAIRKYTAFTIPSINNETPGIRYQYNVLPQGWKGS
PSIFQSSMTKILEPFRAKNPEIVIYQYVDDLYVGSDLEIGQHRAKIEELREHLWKWGFYT
PDKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005