<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GP06_192768 GP06_192768 South Africa 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15V, L19I, M36I, R41K, D60E, H69K, L89M, I93L  
>GP06_192768| codons 1-99
PQITLWQRPIVTIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4T, V35T, E36A, T39E, S48T, K122E, D123NS, K173T, Q174R, N175H, D177E, T200E, Q207E, R211K, F214L, V245L, D250E, K277R  
>GP06_192768| codons 1-283
PISTIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTRHPEIVI
YQYMDDLYVGSDLEIGQHREKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPILLPEKESWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLL

References
Author Title Citation
Hunt, GM Surveillance of transmitted HIV-1 drug resistance in Gauteng and KwaZulu-Natal Provinces, South Africa, 2005-2009. Clin Infect Dis, 2012