<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GP07_219767 GP07_219767 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12S, I15V, L19I, K20R, E35D, M36I, R41K, D60E, L63V, H69K, I85V, L89M, I93L  
>GP07_219767| codons 1-99
PQITLWQRPVVSIKVGGQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYE
QIVIEICGKKAIGTVLVGPTPVNIVGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36EG, T39EK, S48T, E53D, K122A, S162SC, T165TI, K173A, Q174NS, D177E, T200A, Q207E, R211K, V245Q, A272P, K277R, E291D, I293V I178IT
>GP07_219767| codons 1-298
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTGICKEMEKEGKITKIGPDNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DADFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMIKILEPFRASNPETVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDVVPLTEE

References
Author Title Citation
Hunt, GM Surveillance of transmitted HIV-1 drug resistance in Gauteng and KwaZulu-Natal Provinces, South Africa, 2005-2009. Clin Infect Dis, 2012