<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GP08_0234 GP08_0234 South Africa 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, N37NT, R41K, K55R, L63I, H69K, V77I, L89M, I93L  
>GP08_0234| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEMTLPGKWKPKMIGGIGGFIRVRQYD
QIIIEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39A, S48T, E53D, K122E, D123G, S162C, K173A, D177E, I195L, T200A, I202V, Q207EK, R211RK, V245Q, A272P, K277R  
>GP08_0234| codons 1-277
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKITKIGPDNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLELGQHRAKVEELRKHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVR

References
Author Title Citation
Hunt, GM Surveillance of transmitted HIV-1 drug resistance in Gauteng and KwaZulu-Natal Provinces, South Africa, 2005-2009. Clin Infect Dis, 2012