<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, R57K, L63I, H69K, L89M  
>SNH068| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIIIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35IT, E40D, V60I, D121H, K122E, I135T, K173L, Q174K, D177E, V179I, I202V, Q207A, R211S, P243ST, V245E, D250E, K281R, T286A, E291D, V292I, I293V, P294A, E312D  
>SNH068| codons 1-321
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIII
YQYMDDLYVGSDLEIGQHRTKVEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIELPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVALTEEAE
LELAENREILKDPVHGVYYDP

References
Author Title Citation
Kiptoo, M HIV-1 drug resistance-associated mutations among hiv-1 infected drug-naive antenatal clinic attendees in rural Kenya. BMC Infect Dis, 2013