<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VT65 VT65 Brazil 2002 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, K49R, I135V, S162C, E169D, K173A, Q174K, R206K, Q207R, L210M, R211K  
>VT65| codons 10-235
VKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISRIGPENPYNTPVFAIKKKDST
KWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTA
FTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDIVIYQYMDDLYV
GSDLEIGQHRTKIEELKRHLMKWGFTTPDKKHQKEPPFLWMGYELH

References
Author Title Citation
de Sa Filho, DJ Mutations associated with drug resistance in a population of drug naive HIV-1 infected individuals. Direct Genbank Submission, 2002