<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
08MYKL005 08MYKL005 Malaysia 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, E35D, M36I, R41K, H69K, V77I, L89M, L97I  
>08MYKL005| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLIGPTPVNIIGRNMLTQIGCTINF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39N, K122E, D123S, R172K, K173I, Q174K, D177E, Q207A, R211N  
>08MYKL005| codons 1-236
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKIKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLNWGFTTPDKKHQKEPPFLWMGYELHP

References
Author Title Citation
Ong, LY Molecular diversity of HIV-1 and surveillance of transmitted drug resistance variants among treatment naive patients, 5 years after active introduction of HAART in Kuala Lumpur, Malaysia. J Med Virol, 2013