<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAN2013-116 CAN13-116 Canada 2009 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L89MV L10IV, I13V, I15IV, G16E, E35D, M36L, R41K, R57K, L63T  
>CAN13-116| codons 1-99
PQITLWQRPVVTVKVEGQLKEALLDTGADDTVLEDLNLPGKWKPKMIGGIGGFIKVKQYD
QITIEICGHKAIGTVLVGPTPVNIIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K101Q, I135V, E138A, S162C, K173I, Q174K, I178IM, T200A, Q207E  
>CAN13-116| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPDMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Brooks, JI Local phylogenetic analysis identifies distinct trends in transmitted HIV drug resistance: implications for public health interventions. BMC Infect Dis, 2013