<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAN2013-051 CAN13-051 Canada 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L33I T12A, I13V, N37D, L63P, A71V, I93L  
>CAN13-051| codons 1-99
PQITLWQRPLVAVKIGGQLKEALLDTGADDTVIEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11R, V35I, R83K, D121H, K122E, D123G, I135M, I178M, E204K, Q207E, R211K  
>CAN13-051| codons 1-229
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEGFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEKLREHLLKWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Brooks, JI Local phylogenetic analysis identifies distinct trends in transmitted HIV drug resistance: implications for public health interventions. BMC Infect Dis, 2013