<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAN2013-146 CAN13-146 Canada 2009 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12I, I13V, K14R, G17E, K20I, E34K, M36I, N37D, Q61N, I62M, L63T, C67E, H69K, I72IMT, V77I, L89M  
>CAN13-146| codons 1-99
PQITLWQRPLVIVRIGEQLIEALLDTGADDTVLKEIDLPGRWKPKMIGGIGGFIKVRQYD
NMTIEIEGKKATGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11KNRS, V35T, K49R, K122E, D123N, S162C, K173KAET, Q174HN, D177E, T200EK, Q207E, R211RK  
>CAN13-146| codons 1-229
PISPIETVPVSLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTNNPEIVI
YQYMDDLYVGSDLEIGQHRKKIEELREHLLKWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Brooks, JI Local phylogenetic analysis identifies distinct trends in transmitted HIV drug resistance: implications for public health interventions. BMC Infect Dis, 2013