<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAN2013-050 CAN13-050 Canada 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L33I I13V, E35EQ, N37D, R41RK, K43R, L63P, A71V, I72T, I93L W42W*CY
>CAN13-050| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVIEQMDLPGKYRPKMIGGIGGFIKVRQYD
QIPIEICGHKVTGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21VI, V35I, T69TN, R83RK, D121H, K122E, I135M, S162Y, P176S, T200A, Q207E, R211K, F214FL  
>CAN13-050| codons 1-229
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNSDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLW

References
Author Title Citation
Brooks, JI Local phylogenetic analysis identifies distinct trends in transmitted HIV drug resistance: implications for public health interventions. BMC Infect Dis, 2013