<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
99CMYD6 99CMYD6 Cameroon 1999 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, L19P, K20I, M36I, R41K, H69K, L89M  
>99CMYD6| codons 9-99
PVVTVKIGGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQILIEICG
KKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Tebit, DM Genotypic and phenotypic analysis of HIV type 1 primary isolates from western Cameroon. ARHR, 2002