<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAN2013-038 CAN13-038 Canada 2009 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, R57K, I62V, L63S, A71V, I72T, V77I, I93L  
>CAN13-038| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QVSIEICGHKVTGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P14A, V35T, S162C, K173E, I178L, T200L, Q207E, R211K  
>CAN13-038| codons 1-229
PISPIETVPVKLKAGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFREQNPDLVI
YQYMDDLYVGSDLEIGQHRLKIEELREHLLKWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Brooks, JI Local phylogenetic analysis identifies distinct trends in transmitted HIV drug resistance: implications for public health interventions. BMC Infect Dis, 2013