<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAM63 CAM63 Cameroon 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, E35D, M36I, R41K, L63T, G68E, H69K, K70R, L89M, T91V, I93L  
>CAM63| codons 1-99
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICEKRAIGTVLVGPTPVNIIGRNMLVQLGCTLNF

References
Author Title Citation
Fonjungo, PN Human immunodeficiency virus type 1 group m protease in Cameroon: Genetic diversity and protease inhibitor mutational features. J Clin Microbiol, 2002