<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CM129 CM129 Cameroon 1998 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, I15V, G16E, K20I, M36I, N37S, R41K, L63V, I64L, C67S, H69K, L89M, I93L  
>CM129| codons 1-99
PQITLWQRPIVTVRVEGQLIEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYD
QIVLEISGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Fonjungo, PN Human immunodeficiency virus type 1 group m protease in Cameroon: genetic diversity and protease inhibitor mutational features. J Clin Microbiol, 2002