<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAS061 CAS061 South Africa 2011 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    V106M F227L K20R, V35T, E36A, T39E, S48T, V60I, K122E, E138A, K173A, Q174K, D177E, I178L, G196E, T200A, K201R, E204K, Q207D, R211K, F214L, V245K, A272P, K275R, Q278E, T286A, E291D, V292I, I293V, E328D, I329V  
>CAS061| codons 1-333
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPELVI
YQYMDDLYVGSDLEIEQHRARIEKLRDHLLKWGLTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKELCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIADVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, N37D, R57K, L63P, H69K, T74S, L89M, I93L  
>CAS061| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Sunpath, H High rate of K65R for antiretroviral therapy-naive patients with subtype C HIV infection failing a tenofovir-containing first-line regimen. AIDS, 2013