<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  D67G K101E, V106M   E6K, V35T, T39E, S48T, V60I, T69N, K122E, D123S, I135V, I142V, S162C, K173A, Q174R, D177E, I178L, T200A, Q207E, R211K, H221Y, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, D324E  
>CAS057| codons 1-333
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKGSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSMTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRARNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F T12S, L19T, K20R, M36I, R41K, Q61E, L63P, H69K, I93L  
>CAS057| codons 1-99
PQITLWQRPLVSIKIGGQTREALLDTGADDTVFEEINLPGKWKPKMIGGIGGFIKVRQYD
EIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Sunpath, H High rate of K65R for antiretroviral therapy-naive patients with subtype C HIV infection failing a tenofovir-containing first-line regimen. AIDS, 2013