<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12S, I13V, L19I, K20I, Q61H, L63P, K70E, A71V, V77I  
>306415_RT| codons 1-99
PQITLWQRPLVSVKIGGQIIEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
HIPIEICGHEVIGTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K82R, V118I, I135T, I142V, T165I, R211S, F214L, A272P, K277R, Q278A, T286A, K311R, Q334H, M357I, A376V, T386A, K390R, T397I, A400T, T403S Q91QR, V254I
>306415_RT| codons 1-438
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNRRTQDFWEVRLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTINDIQKLVGKLNWASQIYPGIKVRALCKLLRGAKALTEVIPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGHGQWTYQIYQEPFKNLKTGKYARIRGA
HTNDVKQLTEAVQKIVTESIVIWGKAPKFRLPIQKEIWETWWSEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAE

References
Author Title Citation
Heipertz, RA Jr. Molecular epidemiology of early and acute HIV type 1 infections in the United States Navy and Marine Corps, 2005-2010. ARHR, 2013