<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
306340_RT 306340_RT U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12S, I13V, L19I, K20I, Q61H, L63P, K70E, A71V, V77I  
>306340_RT| codons 1-99
PQITLWQRPLVSVKIGGQIIEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
HIPIEICGHEVIGTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V118I, I135T, I142V, L210S, R211S, F214L, K275R, Q278A, T286A, Q334H, M357T, K366R, K385R, K388R, A400T, T403S  
>306340_RT| codons 1-439
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLSSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIRVKALCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVRQLTEAVQKIATESIVIWGRTPRFKLPIQKETWETWWSEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAET

References
Author Title Citation
Heipertz, RA Jr. Molecular epidemiology of early and acute HIV type 1 infections in the United States Navy and Marine Corps, 2005-2010. ARHR, 2013