<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ETH-G-5713 ETH-G-5713 Ethiopia 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36T, R41K, L63P, H69K, L89M, I93L  
>ETH-G-5713| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEETNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39D, S48T, K122E, Q151*, K173A, D177E, T200A, Q207E, R211K, V245Q, E248D, D250E, A272P, L283I, R284RK, T286A, E291D, V292I, I293V Q145L, N147C, P150L
>ETH-G-5713| codons 1-319
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYLYCVLL*GWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIKGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYY

References
Author Title Citation
Mulu, A Clade homogeneity and pol gene genetic variability in ART naive HIV-1 infected Ethiopian patients. Direct Genbank Submission, 2013