<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ETH-G-5652 ETH-G-5652 Ethiopia 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, R41K, H69K, T74A, L89M, I93L L90LW
>ETH-G-5652| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGAVLVGPTPVNIIGRNMWTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, K43R, K122E, D123G, E138A, S162C, K173A, D177E, V179I, T200A, Q207E, V245Q, A272P, T286A, I293V, P294A  
>ETH-G-5652| codons 1-330
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEREGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAQNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVALTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQ

References
Author Title Citation
Mulu, A Clade homogeneity and pol gene genetic variability in ART naive HIV-1 infected Ethiopian patients. Direct Genbank Submission, 2013