<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12A, I15V, L19I, E35D, M36I, R41K, L63Q, H69Q, L89M, I93L V56VL
>ETH-G-5573| codons 1-99
PQITLWQRPIVAIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKLRQYD
QIQIEICGQKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, K122E, D123S, A158S, K173A, D177E, I178V, T200A, E204K, Q207E, R211K, F214L, V245Q, D250E, A272P, K277R, E291D, V292I, I293V, P294T  
>ETH-G-5573| codons 1-330
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAQNPEVVI
YQYMDDLYVGSDLEIGQHRAKIEKLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQ

References
Author Title Citation
Mulu, A Clade homogeneity and pol gene genetic variability in ART naive HIV-1 infected Ethiopian patients. Direct Genbank Submission, 2013