<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ETH-G-5740 ETH-G-5740 Ethiopia 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36L, R41K, K43R, Q61N, L63A, H69K, T74A, L89M, I93L  
>ETH-G-5740| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDLNLPGKWRPKMIGGIGGFIKVRQYD
NIAIEICGKKAIGAVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Mulu, A Clade homogeneity and Pol gene polymorphisms in chronically HIV-1 infected antiretroviral treatment naive patients after the roll out of ART in Ethiopia. BMC Infect Dis, 2015