<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ETH-G-5740 ETH-G-5740 Ethiopia 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36L, R41K, K43R, Q61N, L63A, H69K, T74A, L89M, I93L  
>ETH-G-5740| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDLNLPGKWRPKMIGGIGGFIKVRQYD
NIAIEICGKKAIGAVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      G190R V35T, T39E, W71*, W88*, K102Q, K122E, D123S, I142V, K166R, K173A, D177E, I178L, T200E, E204K, Q207D, R211K, V245Q, W266*, A272P, E291D, V292I, I293V, E328D, K331N G93R
>ETH-G-5740| codons 1-332
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTK*RKLVDFRELNKRTQDF*EVQLRIPHPAGLKQKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAQNPELVI
YQYMDDLYVRSDLEIGQHREKIEKLRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLN*ASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIADIQNQ

References
Author Title Citation
Mulu, A Clade homogeneity and pol gene genetic variability in ART naive HIV-1 infected Ethiopian patients. Direct Genbank Submission, 2013