<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9987 CA24843 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 104
2 3TC+AZT+IDV 65
3 DLV+NFV+SQV 44
4 EFV+RTV+SQV 67
5 3TC+ABC+APV 33
6 None 35
7 3TC+D4T+IDV+RTV 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M F53L L10I, I15V, G16A, L63P, A71V  
>CA24843| codons 1-99
PQITLWQRPIVTIKVAGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGLVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, M184V, T215Y   K103N   V35X, K122E, I135T, S162C, D250E, K277R, A288S, I293V, E297K  
>CA24842| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALXEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKSLTEVVPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005