<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4001 CA24836 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 95
2 3TC+AZT 8
3 3TC+AZT+IDV 65
4 D4T+DDI+NFV 99
5 ABC+IDV+NVP+RTV 8
6 D4T+DDI+IDV+RTV 74
7 3TC+LPV+NVP 19

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, V75T, M184MIV, T215F K219Q Y181C V108I K20KR, T39N, K104Q, V118I, K122P, I135IT, T139TK, I142V, K166R, D177E, F214L, L228LH, T286TA, I293V, E297K  
>CA24836| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICNELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKKQSVTILDVGDAYFSIPL
DPDFRKYTAFTIPSTNNEKPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M Q58E, G73S L10I, K20R, E35D, M36I, N37D, K55R, I62V, L63P, A71V, I72IL  
>CA24837| codons 1-98
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFVRVREYD
QVPIEICGHKVLSTVLVGPTPANIIGRNLMTQIGCTLN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005