<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4001 CA24835 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 95
2 3TC+AZT 8
3 3TC+AZT+IDV 65
4 D4T+DDI+NFV 99
5 ABC+IDV+NVP+RTV 8
6 D4T+DDI+IDV+RTV 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M Q58E, G73S L10I, K20R, E35ED, M36I, N37ND, K55R, I62V, L63P, A71V  
>CA24835| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFVRVREYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, T215F V75T, K219Q   V108VI K20KR, T39N, K104Q, V118I, K122P, I142V, K166R, D177E, F214L, T286TA, I293V, E297K  
>CA24834| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICNELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKKQSVTILDVGDAYFSIPL
DPDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009