<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5076 CA24832 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 52
2 AZT+DDC 61
3 3TC+AZT 78
4 D4T+DDI+NVP 109
5 3TC+ABC+RTV+SQV 48
6 None 28

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215V, K219Q     K20KR, T27TS, V35I, T39A, V60I, R83K, K103R, I135T, Q197E, R211K, D218E, A272P  
>CA24832| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALIEICAEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGEHRTKIEELRQHLLKWGFVTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, E35D, N37S, L63P, I72V, V77I, I93L  
>CA24833| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005