<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5996 CA24827 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 DDI 47
3 DDC 43
4 AZT+ 3TC 25
5 AZT+ 3TC+ IDV 30
6 RTV+ AZT+ 3TC 60
7 AZT+ 3TC+ NFV 26
8 3TC+ AZT+ NFV+ SQV 21
9 D4T+ 3TC+ NFV+ SQV 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48GV, I84V, L90M G73GS L10I, I13V, E34D, E35ED, M36V, N37S, L63P, A71V, T74TS, I93IL  
>CA24827| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLDDVSLPGRWKPKMIVGIGGFIKVRQYD
QIPIEICGHKVISSVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215F V75VA, K219Q     V35M, K122E, I135L, I178IM, T200A, E203K, Q207E, L228H, E248V  
>CA24826| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLADFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRAKIKELREHLLRWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPVK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005