<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5483 CA24823 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 21
2 AZT+ 3TC+ RTV+ SQV 26
3 AZT+ 3TC+ RTV+ NFV 49
4 3TC+AZT+NFV 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   N37S, I62V, L63P, A71AV, I72V, V77I  
>CA24823| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVVGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       R83K, K103R, T200A, R211K, V245K, E248EK, S251SN, L260V K220KI
>CA24822| codons 1-260
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKIHQKEPPFLWMGYELHPDKWT
VQPIKLPKKDNWTVNDIQKV

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005