<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7907 CA24813 U.S. 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 74
2 3TC+D4T+NFV 186

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, N88D T12P, K14R, I15V, G16E, K20IT, E35G, M36V, R41K, L63T, H69Q, T74S, V77VI, I85IV, L89M, I93L  
>CA24813| codons 1-98
PQITLWQRPFVPIRVEGQLTEALLDTGADNTVLEGVNLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGQKAIGSVLIGPTPVNIVGRDMLTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67DN, T69TADN, K70KR, M184V, T215TFIS K219KQ, N348I     V35T, E36ED, T39N, S48T, V60I, D121Y, K122E, I135IT, K173A, D177E, T200A, E203EK, Q207N, R211K, L228LH, V245Q, A272P, K275Q, K277R, E291D, V292I, I293V, A327V, G335S, I341V, A355S, R356K, G359T, T377M, K390R, A400T, E404D, E432D, V435A, A437V, K454R, V466I, D471E, H483C, L491P, S519N, K530R, A534S, A554S  
>CA24812| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICNELEKEGKITKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIKELRNHLLKWGFSTPDQKHQKEPPFHWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIQVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIVEIQKQGQSQWTYQVYQEPFKILKTGKYSKMRTA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIAGVETFYVDGAANRETKLGRAGYVTDRGRQKIVSLTETTNQKTELQ
AICLALQDSGPEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005