<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39K, K43E, S48T, T69S, K122E, D123N, S162C, K173R, Q174E, D177E, I178M, E204K, Q207A, R211S, K238R D113N
>cdh27| codons 1-238
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKITKIGPENPYNTPV
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGNAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRRENPEMVI
YQYMDDLYVGSDLEIGQHRTKIEKLRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, E35D, M36I, R41K, H69K, L89M  
>cdh27| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Zeng, P HIV-1 genotypic diversity and prevalence of drug resistance among treatment naive HIV-infected individuals in Chengdu of China. Virus Genes, 2013