<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1426 CA24806 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 35
2 AZT+D4T+SQV 30
3 3TC+D4T+IDV 83
4 D4T+DDC+NFV 29
5 DDI+RTV+SQV 8
6 DDC+RTV+SQV 24
7 D4T+EFV+IDV 52
8 ABC+APV+DDI+NVP 68

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L74V, Y115F, Q151M K70S, K219Q Y181C, G190S   V35VI, V60I, T69N, V90I, K101Q, K122E, D123DN, I135V, R172K, G196E, F214FL, D218E, H221HY, V245T, K277R, T286A, I293V, E297K  
>CA24806| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSNSWRKVVDFRELNKRTQDFWEIQLGIPHPAGLQKKKSVTVLDVGDAFFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFKKQNPDIVI
CQYMDDLYVSSDLEIEQHRTKIEELRQHLLRWGLTTPEQKYQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVPLTKEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, I84V V11VI, G73GS, L89V L10I, K20I, N37A, R41K, L63P, A71V, V77I, I85V, I93L  
>CA24807| codons 1-98
PQITLWQRPIITIKIGGQLIEALLDTGADDTVLEEMALPGKWKPKIIGGIGGFMKVRQYD
QIPIEICGHKVISTVLIGPTPVNVVGRNVLTQLGCTLN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005