<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14170 CA24803 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 35
2 3TC+AZT 13
3 3TC+AZT+NFV 39
4 3TC+DDI+IDV 19
5 Unknown 158

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, K14KR, K20MV, R41K, R57K, L63P, I64IV, A71T, I93IL  
>CA24803| codons 1-99
PQITLWQRPLVTVRIGGQLMEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVKQYD
QIPVEICGHKTIGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F       I135T, I142V, V292I, I293V L289LR, A299AG, E302E*
>CA24802| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKARTEIVPLTEEGE
L*L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005