<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1128 CA24801 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 47
2 DDI+ AZT 49
3 DDC+ AZT 5
4 RTV+ DDI+ AZT 22
5 RTV+ AZT+ 3TC 10
6 IDV+ AZT+ 3TC 15
7 IDV+ D4T+ 3TC 23
8 SQV+ IDV+ D4T+ 3TC 67
9 ADV+ 3TC+ D4T+ NFV+ SQV 127
10 SQV+ NFV+ D4T+ 3TC 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V L24I L10I, D60E, L63P, I64V, A71V  
>CA24801| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYE
QIPVEICGHKVIGTVLVGPTPANVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219Q     E6D, T39A, E44D, K122E, I142V, I202V, R211K, T286A, A288T  
>CA24800| codons 1-288
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLWKWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKT

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005