<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9991 CA24794 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 48
2 D4T 65
3 3TC+AZT 31
4 3TC+D4T+RTV 83
5 DDI+NFV+NVP 26
6 EFV+RTV+SQV 8
7 ABC+EFV+RTV+SQV 46

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219E K103N, Y181YC, G190GA   V35I, T39A, K49R, I50V, V106I, I135L, S162C, E194D, H208Y, R211K, L228H, K277R, I293V, E297K, A304G E40S
>CA24794| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICASLEKEGKISRVGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSITVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLDIGQHRTKIEELRQYLWKWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTKEAE
LELG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   I15V, L63P, I64V, V77I  
>CA24795| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPVEICGHKAIGTVLIGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005